Arsip Disertasi

Ronggeng, Ketuk Tilu, Dan Jaipongan Studi Tentang Tari Rakyat Di Priangan (Abad Ke-19 Sampai Awal Abad Ke-21)

Disertasi ini berisi kajian tentang Ronggeng, Ketuk Tilu dan Jaipongan: ...

Matriks Metaloproteinase-2 Dan Metaloproteinase-9 Pada Berbagai Spektrum Klinis Infeksi Virus Dengue Anak Serta Hubungannya Dengan Hematokrit Fase Akut

Pada infeksi virus dengue produksi matriks metaloproteinase-2 (MMP-2) dan MMP-9 ...

Dinamika Sosial Dalam Mewujudkan Toleransi Beragama (Studi Kasus Program ”Bandung Kota Agamis”)

Fakta adanya keragaman keyakinan, di satu sisi, menjadi modal berharga ...

Pengaruh Implementasi Kebijakan Standar Nasional Pendidikan Terhadap Kualitas Pelayanan Pendidikan Pada Sekolah Menengah Atas Negeri Di Kota Administrasi Jakarta Selatan

Fenomena yang dijadikan obyek penelitian adalah kualitas pelayanan pendidikan pada ...

Pengaruh Lingkungan Eksternal Dan Internal Perusahaan Terhadap Strategi Penetapan Tarif, Serta Implikasinya Terhadap Kinerja Perusahaan Pada Industri Telekomunikasi Di Indonesia (Survey Pada Perusahaan Penyelenggara Jasa Internet Di Indonesia)

Tujuan dari penelitian ini adalah mengkaji pengaruh lingkungan eksternal dan ...

Keunikan Sumber Daya Dalam Membentuk Strategi Kemitraan Dan Strategi Bersaing Untuk Menciptakan Keunggulan Posisi Serta Implikasinya Terhadap Kinerja Rumah Sakit (Suatu Studi Pada Jasa Rumah Sakit Di Indonesia )

Penelitian dalam bentuk kajian disertasi yang menyangkut kinerja rumah sakit ...

Efek Suplementasi Vitamin C Terhadap Kadar Vitamin C Plasma, Bakteri-Virus Periopatogen, Hba1c Dan C-Reactive Protein Pada Penderita Periodontitis Kronis

Vitamin C adalah unsur mikronutrien penting dalam nutrisi yang banyak ...

Pengawasan Pelaksanaan Anggaran (Studi Pada Sekretariat Daerah Pemerintah Kota Tasikmalaya Provinsi Jawa Barat)

Disertasi dengan judul Pengawasan Pelaksanaan Anggaran (Studi di Sekretariat Daerah ...

Kontruksi Makna Bank Konvensional Dan Bank Syariah Oleh Nasabah Beragama Islam (Studi Fenomenologi)

Disertasi ini bertujuan untuk memahami makna yang dikonstruksi oleh nasabah ...

Implementasi Kebijakan Wajib Belajar Pendidikan Dasar Di Kabupaten Karawang

Penelitian ini difokuskan pada upaya peningkatan Indeks Pendidikan ditinjau dari ...

Komunikasi Dakwah Kaum Migran Studi Komunikasi Antarbudaya Dengan Pendekatan Fenomenologi Pada Da’i Kaum Migran Dalam Dakwah Islam Di Kota Bengkulu

Penelitian dengan judul Komunikasi Dakwah Kaum Migran di Kota Bengkulu ...

Komunikasi Organisasi Di Sekretariat Jenderal Dpr Ri

Sekretariat Jenderal Dewan Perwakilan Rakyat Republik Indonesia (Setjen DPR RI) ...

Praktik Perceraian Pada Keluarga Rote Thie Di Desa Tanah Merah, Kupang – Ntt (Divorce Practices On Rote Thie Families In Tanah Merah Village, Kupang – Ntt)

Penelitian ini bertolak dari fenomena tentang Praktik Perceraian yang sering ...

Pengaruh Kompetensi Aparatur Terhadap Kualitas Pelayanan Kesehatan Di Rumah Sakit Umum Daerah Kabupaten Sumedang

Masalah pokok dalam penelitian ini adalah rendahnya kualitas pelayanan kesehatan ...

Kewenangan Komisi Yudisial Dalam Kaitannya Dengan Kemerdekaan Kekuasaan Kehakiman Berdasarkanuud 1945

Disertasi ini merupakan hasil penelitian dan kajian terhadap Kewenangan Komisi ...

Pengaruh Kompetensi Aparatur Dan Komunikasi Terhadap Efektivitas Pelayanan Pendaftaran Tanah Di Kantor Pertanahan Kota Bandung

Padapenelitianini yang memnjaasdailah utamaadalahefektivitaspelayananpendaftarantanah di Kantor Pertanahan Kota Bandungtidak optimal.Masalah ...

Bioavailabilitas Kalsium Dan Fosfor Special Bone Meal Produk Hidrolisis Alkali Tulang Ikan Cakalang (Katsuwonus Pelamis L) Pada Ayam Broiler

Tulang ikan merupakan limbah industri pengolahan hasil perikanan yang potensial ...

Pertanggungjawaban Pidana Korporasi Terhadap Tindak Pidana Hak Cipta Atas Ciptaan Multimedia Melalui Sarana Teknologi Digital

Penelitian ini dimaksudkan untuk melakukan kajian dan analisis terhadap: ( ...

Kajian Hukum Persaingan Usaha Industri Media Massa Nasional Dikaitkan Dengan Kemerdekaan Pers Dalam Tujuan Negara Kesejahteraan

Persaingan usaha tidak sehat antarpelaku media massa nasional di era ...

Metode Tumpang Padu Otot Bibir Lingkar Atas Dan Tengah Pada Keberhasilan Kesimetrisan Anatomi Hidung Dan Bibir Atas Pascalabioplasti Unilateral

Ketidak jelasan dan ketidak pastian mengenai faktor penyebab dan mekanisme ...

Formulasi Program Pendidikan Perempuan Pada Dinas Pendidikan Propinsi Lampungdi Propinsi Lampung

Penelitian ini berangkat dari masalah penelitian yang dinyatakan dalam bentuk ...

Peranan Klen Dalam Partisipasi Politik Perempuan Masyarakat Kaili Di Lembah Palu Sulawesi Tengah

Salah satu fenomena dalam realitas politik yang muncul setelah masa ...

Elektrifikasi Kawasan Perbatasan: (Studi Tentang Perubahan Sosial Ekonomi Dan Kesejahteraan Masyarakat Di Kecamatan Sajingan Besar Kabupaten Sambas)

Wilayah perbatasan Republik Indonesia di Kalimantan Barat, memiliki potensi sumber ...

Penerbitan Surat Berharga Syariah Negara Sebagai Instrumen Investasi Dalam Menunjang Pembangunan Ekonomi Indonesia Dikaitkan Dengan Kepastian Hukum Bagi Investor

Surat Berharga Syariah Negara (SBSN) adalah surat berharga negara yang ...

Implementasi Kebijakan Anggaran Pendidikan Di Kabupaten Kepulauan Talaud

Pemerintah pusat dan daerah berkewajiban menjamin terselenggaranya wajib belajar, termasuk ...

Cacat Dan Prestasi Melalui Pengalaman Komunikasi Atlet Penyandang Cacat

Disertasi dengan judul Cacat dan Prestasi Melalui Pengalaman Komunikasi Atlet ...

Perkembangan Peraturan Delegasi Di Indonesia

Pengkajian peraturan delegasioleh banyak pakar di berbagai negara, yang terpenting ...

Penerapan Rencana Tata Ruang Wilayah Dalam Pembangunan Permukiman Perkotaan Yang Berkeadilan, Berwawasan Lingkungan, Dan Berkelanjutan

Indonesia sebagai negara kesejahteraan berkewajiban melakukan pembangunan permukiman dan perumahan ...

Hubungan Polimorfisme Gen Me2 (Malic Enzyme) Dengan Epilepsi Idiopatik Umum Dan Respon Terapi Valproat

Epilepsi idiopatik umum (EIU) adalah sindrom epilepsi yang disebabkan oleh ...

Kajian Pengaruh Ozon, Kemasan Plastik Dan Suhu Penyimpanan Terhadap Keamanan, Mutu Dan Umur Simpan Kubis Bunga Diolah Minimal

Penyajian kubis bunga dalam bentuk potongan kuntum yang kemudian disebut ...

Evolusi Batuan Magmatik Dan Metalogenesa Kompleks Granitoid Sibolga, Sumatra Utara

Evolusi geologi Paleosoik Akhir ¡V Mezosoik pada provinsi metalogenesis Asia ...

Model Pengelolaan Sumberdaya Perikanan Pelagis Secara Terpadu Dan Berkelanjutan Di Perairan Teluk Tomini

Penelitian mengenai Model Pengelolaan Sumberdaya Perikanan Pelagis Secara Terpadu dan ...

Reinvensi Dan Implementasi Atas Pemaknaan Televisi Publik

Televisi Republik Indonesia (TVRI) masih dihadapkan pada krisis identitas antara ...

Perspektif Ekonomi Makro, Fundamental Perusahaan Dan Analisis Aspek Teknikal Terhadap Imbal Hasil Saham

Perkembangan pasar modal yang sangat dinamis, fluktuatif dan berisiko, menuntut ...

Peran Pemimpin Terhadap Organisasi Pembelajar Dan Kompetensi Organisasiserta Dampaknya Pada Kinerja Organisasi

Dalam rangka menghasilkan lulusan program studi yang berkualitas dibutuhkan peran ...

Peranan Tektonik Dalam Membentuk Geomorfologi Wilayah Das Jeneberang Sulawesi Selatan

Penelitian mengenai peranan tektonik membentuk tatanan Geomorfologi DAS Jeneberang dilatarbelakangi ...

Pemanfaatan Alel Gen Xa7 Dan Gen Osirt1 Dalam Pembentukan Galur Harapan Padi Tahan Penyakit Hawar Daun Bakteri (Hdb) Dan Toleran Keracunan Fe

Aksesi-aksesi plasma nutfah padi lokal Indonesia yang sejak lama telah ...

Pelayanan Publik Bidang Pertanahan : Pelayanan Sertifikat Hak Milik Pada Kantor Pertanahan Kota Bandar Lampung

Demam neutropenia pada anak dengan Leukemia Limfoblastik Akut (LLA) merupakan ...

Soft Power Dalam Penyelesaian Konflik : Studi Tentang Politik Desentralisasi Di Aceh

Konflik Aceh yang berlangsung selama 3 (tiga) dekade dapat diselesaikan ...

Pemberdayaan Guru Sekolah Dasar Di Jakarta Selatan

Guru sekolah dasar di Jakarta Selatan dianggap belum mampu melaksanakan ...

Implementasi Kebijakan Pemberdayaan Masyarakat Keluarga Miskin Kelompok Usaha Peningkatan Pendapatan Keluarga Sejahtera (Uppks) Di Kota Pontianak Provinsi Kalimantan Barat

Fokus penelitian ini adalah implementasi kebijakan pemberdayaan masyarakat keluarga miskin ...

Pengaruh Komitmen Profesi Akuntan, Komitmen Organisasi Kantor Akuntan Publik Terhadap Kepuasan Kerja Auditor Dan Implementasi Audit Independen Atas Laporan Keuangan Dan Implikasinya Terhadap Kualitas Audit

Kantor Akuntan Publik (KAP) dalam memberikan layanan jasa audit yang ...

Kemiskinan Dalam Tayangan Charity Reality Show Di Indonesia

Media memiliki kekuatan untuk memindahkan realitas sosial ke dalam sebuah ...

Pengaruh Independensi Akuntan Publik, Spesialisasi Auditor Di Bidang Industri Klien, Dan Karakteristik Personal Terhadap Kualitas Audit Serta Implikasinya Terhadap Tingkat Kepercayaan Auditee (Survey Pada Akuntan Publik Yang Terdaftar Di Bapepam-Lk)

Pengaruh Independensi Akuntan Publik, Spesialisasi Auditor Di Bidang Industri Klien, ...

Pelayanan Publik Pada Dinas Perindustrian, Perdagangan, Koperasi Dan Usaha Kecil Menengah Kabupaten Ogan Komering Ulu Sumatera Selatan

Permasalahan penelitian (research problems) ini adalah masih banyak pengusaha (pengguna ...

Gatekeeper Program Televisi : Di Antara Idealisme Dan Komersialisme

Siti Karlinah : 170130070021 ; Gatekeeper Program Televisi di antara ...

Evaluasi Program Pemberdayaan Masyarakat Di Kabupaten Purbalingga Jawa Tengah

Keberhasilan suatu program seringkali menjadi kontroversi ketika hasil yang dicatat ...

Pengaruh Fee Audit, Pengalaman Audit Dan Independensi Akuntan Publik Terhadap Tekanan Anggaran Waktu Audit Dan Dampaknya Terhadap Kualitas Audit (Survei Pada Kantor Akuntan Publik Yang Terdaftar Di Bapepam-Lk)

Berbagai kasus laporan keuangan dan pelanggaran yang dilakukan oleh akuntan ...

Dinamika Aliran Kepercayaan Madrais Di Cigugur Kabupaten Kuningan 1885-2007

Disertasi ini adalah tentang Dinamika Aliran Kepercayaan Madrais dari 1885 ...

Pengaruh Fungsi Audit Internal Dan Fungsi Komite Audit Terhadap Pelaksanaan Good Corporate Governance Serta Implikasinya Terhadap Kinerja Keuangan

Sejak tahun 2000 sampai dengan 2010 masih terdapat Badan Usaha ...

Komunikasi Antarbudaya Etnik Batak Dan Etnik Sunda Di Kota Bandung

Penelitian ini bertujuan untuk menelaah identitas etnik Batak di lingkungan ...

Implementasi Fungsi Pengawasan Dewan Perwakilan Daerah Terhadap Pelaksanaan Undang Undang

Dewan Perwakilan Daerah adalah lembaga baru, terbentuk berdasarkan hasil perubahan ...

Tanggungjawab Negara Menjamin Dan Melindungi Kemerdekaan Beragama Dan Berkepercayaan Berdasarkan UUD 1945

Indonesia adalah negara berdasarkan Ketuhanan Yang Maha Esa yang mengandung ...

Pengaruh Karakteristik Budaya Organisasi Terhadap Kualitas Pelayanan Kesehatan Di Dinas Kesehatan Kabupaten Nabire Provinsi Papua

Dalam kurun waktu berlakunya orde lama dan orde baru, pola ...

Pengaruh Penerapan Peran Komite Audit, Peran Dewan Pengawas Syariah, Dan Efektivitas Pengendalian Intern Atas Pelaporan Keuangan Terhadap Kualitas Pelaporan Keuangan

Penelitian ini menguji pengaruh peran komite audit, peran dewan pengawas ...

Model Pengelolaan Perikanan Terubuk (Tenualosa Macrura) Terpadu Dan Berkelanjutan Di Perairan Bengkalis, Riau

Penelitian telah dilakukan untuk mengkaji berbagai aspek (ancaman) yang bisa ...

ANALISIS PERUBAHAN STRUKTUR EKONOMI DAN DEKOMPOSISI OUTPUT PEREKONOMIAN PROVINSI-PROVINSI DI INDONESIA

Tujuan utama dari studi ini adalah berusa membuktikan bahwa sejalan ...

Pengaruh Sistem Pengendalian Intern Pemerintah, Implementasi Standar Akuntansi Pemerintahan, Penyelesaian Temuan Audit Dan Kualitas Laporan Keuangan Pemerintah Daerah Terhadap Penerapan Prinsip-Prinsip Tata Kelola Pemerintahan Yang Baik

Tuntutan masyarakat kepada Pemerintah untuk menyelenggarakan pemerintahan yang baik, direspon ...

Kedudukan Dan Fungsi Desa Dalam Kerangka Otonomi Daerah Di Indonesia Dan Prospeknya Di Masa Datang

Penelitian disertasi ini berjudul kedudukan dan fungsi desa dalam kerangka ...

Pengembangan Metode Pengenalan Wajah Berbasis Ment Invariant Dan Linear Discriminant Analysis Serta Implementasinya Pada Robot

Pengenalan wajah merupakan salah satu bidang biometrika dan visi komputer ...

Pengaruh Implementasi Kebijakan Penataan Ruang Terhadap Efektivitas Pemanfaatan Ruang Terbuka Hijau Kawasan Perkotaan Di Kota Cimahi

Penelitian ini mengkaji pengaruh implementasi kebijakan penataan ruang terhadap efektivitas ...

Pengaruh Kinerja Bauran Pemasaran Jasa Dan Nilai Pelanggan Terhadap Tingkat Kepercayaan Serta Implikasinya Pada Loyalitas Pelanggan (Survai Pasien Pengobatan Alternatif Di Kota Bandung) The Influence Of Service Marketing Performance And Customer Value In Shaping The Level Of Trust In An Effor To Improve Customer Loyality (Survey Of Alternative Medicine Customer In The City Of Bandung)

Penelitian ini dilakukan untuk mengetahui bagaimana persepsi pelanggan terhadap kinerja ...

Konstruksi Diri Dan Perilaku Komunikasi Gelandangan Di Kota Jakarta (Studi Fenomenologi Terhadap Julukan Gelandangan “Manusia Gerobak”)

Gembel, kotor, sampah masyarakat mengganggu ketertiban dan biang kriminal adalah ...

Pengaruh Implementasi Kebijakan Bidang Metrologi Terhadap Kualitas Pelayanan Pada Balai Kemetrologian Provinsi Jawa Barat The Influence Of Policy Implementation Of Metrology To Service Quality At Metrology Unit Of West Java Province

Masalah dalam penelitian ini adalah belum optimalnya implementasi kebijakan di ...

Kinerja Komisi Pemilihan Umum (Kpu) Kota Palu Dalam Pemilihan Umum Presiden Dan Wakil Presiden Ri Tahun 2009 Di Kota Palu The Performance Of The General Election Commission Palu City In The General Election President And Vice President Ri In 2009 In The Palu City

Penelitian ini bertitik tolak dari fenomena yang mengindikasikan belum memuaskannya ...

Implementasi Kebijakan Pemerintahan Gampong Di Provinsi Nanggroe Aceh Darussalam ( Studi Di Kabupaten Pidie ) The Policy Implementation Of Gampong Government In Nanggroe Aceh Darussalam Province (Study In Pidie Regency)

Pemerintahan gampong merupakan unit pelayanan pemerintahan terendah dalam struktur pemerintahan ...

Perkebunan Kelapa Sawit Rakyat Dan Dampaknya Terhadap Perubahan Stratifikasi Dan Pranata Sosial Perdesaan Di Nagari Kinali Kecamatan Kinali Kabupaten Pasaman Barat Provinsi Sumatera Barat The Smallholder’s Oil Palm Plantation And Its Impact On The Changes Stratification And Social Institutions Of Rural Society In Nagari Kinali Sub District Of Kinali West Pasaman Regency West Sumatra Province

Perkembangan perkebunan kelapa sawit secara pesat sejak dua dekade terakhir ...

Pengaruh Risiko, Internal Auditing, Good Corporate Governance, Ukuran Perusahaan Dan Tingkat Suku Bunga Terhadap Kinerja Perusahaan Dan Reaksi Pasar (Studi Pada Bumn Yang Telah Mencatatkan Sahamnya Di Bursa Efek Indonesia)

Studi ini terdiri dari 2 (dua) penelitian yaitu : 1. ...

Pelayanan Pendidikan Sekolah Lanjutan Tingkat Pertama Di Kabupaten Jayawijaya Provinsi Papua Education Services Of Secondary School In Jayawijaya Regency Papua Province

Penyelenggaraan pelayanan pendidikan merupakan salah satu proses pemberdayaan masyarakat melalui ...

Peran Laktat Dalam Larutan Natrium Laktat Hipertonik Sebagai Neuroprotektor Diukur Dari Kadar Atp, Mct-1 Dan Luas Daerah Nekrosis Pada Tikus Model Hematoma Intraserebral The Role Of Lactate In Hypertonic Sodium Lactate Solution As A Neuroprotector Based On Atp , Mct-1 And Necrotic Area In Rat Model Intracerebral Hematoma

Hematoma Intraserebral (HIS) merupakan penyakit dengan angka kematian dan kecacatan ...

Komunikasi Antarpribadi Dan Kelompok Dalam Filantropi Pascagempa (Studi Kasus Pada Pelaku Usaha Gerabah Di Kasongan, Yogyakarta) Interpersonal And Group Communication In Post Earthquake Philanthropy (The Case Study On People Of Desa Gerabah Kasongan, Yogyakarta)

Penelitian ini bertujuan mendapatkan pemahaman tentang pemaknaan dan pelaksanaan ...

Efisiensi, Skala Ekonomis Dan Cakupan Ekonomis: Studi Pada Perbankan Syariah Di Indonesia Efficiency, Economies 0f Scale And Scope: Study On Syaria Bank In Indonesia

Penelitian ini menganalisis efisiensi biaya dengan menggunakan Stochastic Frontier Approach ...

Pengaruh Pemimpin Pengetahuan Terhadap Organisasi Pembelajaran Dan Manajemen Pengetahuan Serta Implikasinya Terhadap Kinerja Tim Pekerja Pengetahuan (K-Workers) Pada Instansi Keuangan (Studi Pada Instansi Keuangan Di Enam Propinsi Wilayah Sulawesi) The Influence Of Knowledge Leader To Learning Organization And Knowledge Management And Its Implication To Teams Performance K-Workers Of Financial Institute (Studies In Financial Institutions In The Six Provinces Of Sulawesi Region)

Penelitian ini dilakukan untuk mengetahui bagaimana; pemimpin pengetahuan, organisasi pembelajaran, ...

Fungsi Penataan Organisasi Perangkat Daerah (Opd) Dalam Pelayanan Dasar Bidang Sarana Dan Prasarana Jalan Dan Jembatan Di Daerah Perbatasan Kabupaten Sanggau Kalimantan Barat – Malaysia Timur The Function Of Local Government Restructuring (Lgr) In The Basic Services Of Roads And Bridges In The Border Region Of Sanggau Regency Of Western Kalimantan – Eastern Malaysia

Disertasi ini berusaha untuk menelaah Penataan Organisasi Perangkat Daerah (OPD) ...

Penafsiran Hukum Penyidik Polri Dalam Penyidikan Perkara Pidana Pada Sistem Peradilan Pidana Indonesia Legal Interpretation Of The Indonesian National Police Investigators Within Criminal Case Investigations At The Indonesian Criminal Justice System

Penyidikan yang dilakukan oleh Penyidik Polri, terutama diatur dalam KUHAP, ...

Keberadaan Dan Hubungan Lembaga Negara Penunjang Dengan Lembaga Negara Utama Dalam Sistem Ketatanegaraan Indonesia The Existence And It’s Relation Of State Auxiliary Bodies With The Main State Institution Within The Constitutional System Of Indonesia

Lembaga negara penunjang di Indonesia banyak lahir setelah perubahan UUD ...

Pengaruh Implementasi Pengendalian Intern,Budaya Organisasi Dan Total Quality Management Dalam Penerapan Good Governance Dan Implikasinya Terhadap Kinerja Organisasi Dengan Kepercayaan Konsumen Sebagai Variabel Intervening (Studi Pada Lembaga Amil Zakat Seluruh Indonesia) The Influence Of Implementation Of Internal Control, Organization Culture And Total Quality Management On Application Of Good Governance And Its Implication To Organizational Performance Trough Customer Trust Intervening (A Study On Lembaga Amil Zakat In Indonesia)

Penelitian ini bertujuan untuk menganalisis: (1) Pengaruh implementasi pengendalian intern, ...

Respons Jarak Pagar (Jatropha Curcas L.) Terhadap Pupuk Organik, Nitrogen, Dan Fosfor Di Dua Lokasi Berbeda Response Of Physic Nut (Jatropha Curcas L.) To Organic,Nitrogen, And Phosphorous FertilizersIn Two Different Locations

Santi Rosniawaty. 2011. Respons Jarak Pagar (Jatropha curcas L.) terhadap ...

Pengaruh Budaya Organisasi Dan Dukungan Supervisor Terhadap Kompetensi Talent Employees Yang Berdampak Kepada Komitmen Organisasional (Survai Pada Perusahaan Manufaktur Besar Di Kawasan Industri Wilayah Propinsi Jawa Barat ) The Influenced Of Organizational Culture And Supervisor Support To Talent Employees ompetence That Impact On Organizational Commitment (Survei On Manufactured Firm In Industrial Estate Province West Java)

Tujuan dari penelitian ini adalah menganalisis pengaruh budaya organisasi dan ...

Adsorpsi Dan Residu Paraquat, Sifat Tanah Serta Bobot Kering Tanaman Jagung Pada Berbagai Subgrup Tanah Akibat Pemberian Amelioran Paraquat Adsorption And Its Residue, Some Soil Properties, And Dry Weight Of Corn Plant On Various Soil Subgroups Due To Ameliorant Application

Paraquat (1,1'-dimethyl-4,4'-bipyridylium dichloride) dikenal sebagai herbisida yang sangat toksik dan ...

Fenomena Politisi Artis Di Dewan Perwakilan Rakyat Republik Indonesia Dan Dewan Perwakilan Rakyat Daerah Kabupaten (Studi Fenomenologi Tentang Konstruksi Realitas Komunikasi Politik Anggota Legislatif Artis Periode 2009-2014) Phenomenon Artists As Politicians In People’s Representative Council Republic Of Indonesia And People’s Representative Council Of District Area (Phenomenological Study About Reality Construction Of Political Communication Of Artist As Legislative Members Period Of 2009-2014)

Disertasi dengan judul Fenomena Politisi Artis Di DPR RI dengan ...

Kajian Yuridis Terhadap Sekuritisasi Aset Sebagai Sarana Pembiayaan Perusahaan Dalam Rangka Menunjang Pembangunan Ekonomi Indonesia

Keberhasilan Pembangunan Ekonomi dapat diwujudkan antara lain melalui kegiatan usaha. ...

Konstruksi Makna Dan Perilaku Komunikasi Terpidana Kelompok Teroris (Studi Kasus Terpidana Aksi Teror Pasca Konflik Poso Di Sulawesi Tengah) The Meaning Construction And Communication Behaviour Of The Condemned Terrorist Group (A Case Study Of Terrorist Prisoners After The Poso Conflict In Poso Central Sulawesi)

Penelitian dengan judul Konstruksi Makna dan Perilaku Komunikasi Terpidana Kelompok ...

Perencanaan Strategik Pelayanan Air Bersih Pada Pdam Kota Bandar Lampung (The Strategic Planning Of The Water Supply Service In Pdam Bandar Lampung)

Penelitian ini berjudul “Perencanaan Strategik Pelayanan Air Bersih pada PDAM ...

Optimalisasi Daya Dengan Stabilisasi Tegangan Pada Pemodelan Pembangkit Listrik Nano Hidro Power Optimization With Voltage Stabilization On Modeling Of Nano Hydro Power Generation

Permasalahan energi di Indonesia meliputi ketergantungan yang tinggi pada sumber ...

Pengaruh Nilai-Nilai Personal, Servant Leadership Dan Iklim Pelayanan Terhadap Customer Oriented-Organizational Citizenship Behavior (Studi Pada Manajer Lini Di Organisasi Bidang Pariwisata Jawa Barat )

Dalam lingkungan usaha jasa yang semakin kompetitif dan isu tentang ...

Respon Deformasi, Transgresi – Regresi, Dan Geomorfologi Tektonik Di Daerah Apaumagida (Apowo), Enarotali, Dan Pegunungan Legare Akibat Tektonik Papua Response Of Deformation, Transgression-Regression, And Tectonic Geomorphology In Apaumagida (Apowo), Enarotali, And Pegunungan Legare Area Due To Tectonic Papua

Papua sebagai pulau terbesar di Indonesia bagian timur memiliki tatanan ...

Pola Komunikasi Anak Di Sekolah Inklusif (Studi Etnografi Komunikasi Di Sd Muhammadiyah 7 Bandung) Children Communication Pattern In Inclusive School (An Etnography Of Communication Study In Sd Muhammadiyah 7 Bandung)

Ike Junita Triwardhani: 210130080001; Pola Komunikasi Anak di Sekolah Inklusif ...

Implementasi Kebijakan Pengendalian Kebakaran Hutan Dan Lahan Di Kabupaten Rokan Hilir Provinsi Riau (Forest Fires And Land Policy Implementation At Rokan Hilir Regency, The Province Of Riau)

Penelitian ini didasari pada masalah bencana kebakaran hutan dan lahan ...

Pengaruh Penerapan Standar Auditing, Kode Etik, Kualitas Auditor Terhadap Pelaksanaan Audit Dan Implikasinya Pada Pendeteksian Fraud (Penelitian Pada Auditor Badan Pemeriksa Keuangan Republik Indonesia Perwakilan Provinsi Jawa Barat) The Effect Of Auditing Standards Implementation, Codes Of Conduct, Auditors’ Quality On Audit Implementation And Its Implication In Fraud Detection (Research On Auditor At The Audit Board Of The Republic Of Indonesia Representative Office Of West Java Province)

Penelitian ini dilakukan untuk menganalisis pengaruh Penerapan Standar Pemeriksaan, Kode ...

Kebijakan Kriminal Terpadu Dalam Rangka Perlindungan Perempuan Dari Kekerasan Dalam Rumah Tangga Integrated Criminal Policy Within The Framework Of Protection Of Women From Domestic Violence

Disertasi ini menyajikan hasil penelitian tentang Kebijakan Kriminal Terpadu Rangka ...

Iklan Politik Pemilihan Presiden (Konstruksi Makna Dan Strategi Pesan Iklan Politik Televisi Oleh Konsultan Politik Pada Pemilihan Presiden Tahun 2009 ) Presidential Election Of Political Ads (Construction Of Political Meaning And Strategies On Television Advertising Messages By Political Consultants In Presidential Election Year 2009).

Penelitian ini berjudul Iklan Politik Pemilihan Presiden ...

Manfaat Imunisasi Ulang Tetanus Difteria (Td) Pada Remaja Sebagai Salah Satu Upaya Mencegah Reemerging Disease Di Indonesia Ditinjau Dari Aspek Imunogenisitas Dan Keamanannya Berdasarkan Pengurangan Dosis Vaksin Difteria The Benefits Of Booster Tetanus Diphtheria (Td) Immunization On Adolescent To Prevent Reemerging Disease In Indonesia A Review Of Immune Response And Safety Perspective Based On Reduced Dose Diphtheria Vaccine

Hasil telaahan pada era tahun 1990-an di negara Sovyet terdapat ...

korelasi kadar serum ifn-γ, ekspresi dan fungsi reseptor ifn-γ, dengan kejadian tuberkulosis paru

Meskipun Tuberkulosis Paru (TB Paru) adalah penyakit menular tetapi tidak ...

Dampak Pencemaran Sumber Daya Air Terhadap Aktivitas Ekonomi Akuakultur Di Waduk Saguling Daerah Aliran Sungai Citarum Provinsi Jawa Barat Indonesia

Waduk Saguling yang secara hidrologis terletak di DAS Citarum Hulu ...

Pengaruh Kepribadian Produktif Dan Social Capital Terhadap Tingkah Laku Improvement (Studi Empiris Pada Survivor Gempa Bumi Di Bantul, Yogyakarta)

Tema besar penelitian ini adalah tingkah laku improvement pada survivor, ...

Adaptasi Masyarakat Kota Cimahi Dalam Implementasi Kebijakan E-Government (Studi Pada Pengajuan Izin Mendirikan Bangunan) Society Adaptation In Cimahi City On The E-Government Policy Implementation (Study Of Building Licency Filing)

Perkembangan teknologi, informasi dan komputer turut mempengaruhi kehidupan manusia saat ...

Implementasi Kebijakan Izin Mendirikan Bangunan (Imb) Di Kota Cimahi

Kebijakan Izin Mendirikan Bangunan (IMB) bertujuan untuk melakukan pengendalian dan ...

Konservasi Burung Cenderawasih Yapen ( Paradiseae Minor Jobiensis Rotschild) Berbasis Masyarakat Di Kabupaten Kepulauan Yapen Papua Community-Based Conservation Of Bird Of Paradise (Paradiseae Minor Jobiensis Rotschild) In Kepulauan Yapen Region Papua

Penelitian tentang konservasi burung cenderawasih yapen (Paradiseae minor jobiensis Rothschild) ...

Pengaruh Kualitas Auditor Eksternal, Kualitas Proses Pengadaan Jasa Audit, Kecukupan Biaya Jasa Audit Dan Kualitas Auditor Internal Terhadap Kualitas Audit (Survei Pada Perusahaan Manufaktur Yang Terdaftar Di Bursa Efek Indonesia) The Influence Of Quality Of External Auditor, Quality Audit Procurement, Sufficiency Audit Fee, And Quality Of Internal Auditor On Audit Quality (Survey On Manufacturing Companies Listed In Indonesia Stock Exchange)

Terjadinya skandal keuangan mengakibatkan turunnya kepercayaan publik terhadap kualitas audit ...