Pustaka Ilmiah Universitas Padjadjaran

Abstrak

Pengaruh Kompetensi Aparatur Dan Komunikasi Terhadap Efektivitas Pelayanan Pendaftaran Tanah Di Kantor Pertanahan Kota Bandung

Padapenelitianini yang memnjaasdailah utamaadalahefektivitaspelayananpendaftarantanah di Kantor Pertanahan Kota Bandungtidak optimal.Masalah utama ini disebabkan oleh rendahnya kompetensi aparatur dan kualitas komunikasi. Penulis tertarik untuk mengkaji lebih mendalam mengenai kompetensi aparatur, komunikasi dan efektivitas pelayananmelalui penelitian dengan judulpengaruh kompetensi aparatur dan komunikasi terhadap efektivitas pelayanan pendaftaran tanah di Kantor Pertanahan Kota Bandung. Penelitian ini menggunakan desain penelitian explanatory survey, sampel penelitian ditentukan menggunakan teknik proporsional sampling. Instrumen penelitian berupa kuesioner dilakukan uji validitas dengan teknik korelasi product moment dari Pearson dan uji reliabilitas dengan metode belah dua (half split methode). Uji hipotesis dengan menggunakan analisa jalur(path analysis). Hasil uji hipotesis, besarnya pengaruh kompetensi aparatur terhadap efektivitas pelayanan pendaftaran tanah ditentukan oleh dimensi dimensi motif, sifat, konsep diri, pengetahuan dan keterampilan. Besarnya pengaruh komunikasi ditentukan oleh dimensi komunikator, pesan, media, komunikan dan efek. Efektivitas pelayanan dibangun oleh dimensi ketepatan kualitas dan ketepatan kuantitas. Pada Kantor Pertanahan Kota Bandung, variabel kompetensi yang paling dirasakan kurang oleh responden adalah pada dimensi sifat yang terdiridarisifattegas, ramah, teliti, tidakmudahkawatirdansifatingintahu. Sedangkan variabel komunikasi yang paling dirasakan kurang oleh responden adalah dimensi pesan yang terdiri dari menariknya pesan, kejelasan pesan, kesesuaian pesan dan ketepatan waktu penyampaian pesan.

In this research the main problem is the effectiveness of the land registration service at Land Office Municipality of Bandung was not optimal. This main problem is due to the lowness of the apparatus competence and communication quality. The author was interested to study more depth about the apparatus competence, communication and effectiveness service through research which entitle The Influence of apparatus competence and communication toward land registration service effectiveness on Land Office Municipality of Bandung. This research used research design that is explanatory survey, research sample determined by using proportional sampling technique. The research instrument is such as questioners that to be processed by validity test with correlation technique product moment from Pearson and reability test with half split method. Hypothesis test used path analysis. The result of the hypothesis test showed that the bignes of the apparatus competency to the land enrolling service determined by motive dimension, character, self concept, knowledge and skill. The bigness of the influence of communication determined by communicator dimension, massage, media, communicant and effect. The service effectivity to be build by quality exactness dimension and quantity exactness. At Land Office of Municipality Bandung, competency variable to be felt less by respondent was dimension traits consisting of stern, friendly, scrutiny, was not easy to be nervous and the other traits is eager to know. While communication variable that to be felt less by responden was message dimension consisting of the interested message, the clearness message, the proportional message and the exactness time to convey the message.

Untuk keterangan lebih lanjut silahkan menghubungi http://cisral.unpad.ac.id